Structure of PDB 7m5c Chain E Binding Site BS01

Receptor Information
>7m5c Chain E (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASEEQVAQDTEEVFRSYVFYRHQQEQEADPEMVTLPLQPSSTMGQVGRQL
AIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRV
VALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWV
AALNLCN
Ligand information
>7m5c Chain F (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STMGQVGRQLAIIGDDINRRYGGC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5c Structural basis of BAK activation in mitochondrial apoptosis initiation.
Resolution3.06 Å
Binding residue
(original residue number in PDB)
I85 R88 Y89 M96 H99 I114 S117 L118 N124 W125 G126 R127 N182 C184
Binding residue
(residue number reindexed from 1)
I57 R60 Y61 M68 H71 I86 S89 L90 N96 W97 G98 R99 N154 C156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7m5c, PDBe:7m5c, PDBj:7m5c
PDBsum7m5c
PubMed35017502
UniProtQ16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)

[Back to BioLiP]