Structure of PDB 7m3t Chain E Binding Site BS01

Receptor Information

>7m3t Chain E (length=144) Species: 12881 (Satellite tobacco mosaic virus)

NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF
RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN
INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Ligand information

>7m3t Chain i (length=5)

uuuuu

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7m3t Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R79 S155
• Binding residue (residue number reindexed from 1): R64 S140

Gene Ontology

Molecular Function

• GO:0005198 structural molecule activity

Cellular Component

• GO:0019028 viral capsid

External links

• PDB: RCSB:7m3t, PDBe:7m3t, PDBj:7m3t
• PDBsum: 7m3t
• PubMed: 34866603
• UniProt: P17574|COAT_STMV Coat protein