Structure of PDB 7las Chain E Binding Site BS01

Receptor Information
>7las Chain E (length=183) Species: 85708 (Porcine circovirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSTAVSTLLESGSLVTVAEQHPVTFVRNFRGLAELLKVSGKMQKRDWKTN
VHVIVGPPGCGKSKWAANFADPETTYWKPPRNKWWDGYHGEEVVVIDDFY
GWLPWDDLLRLCDRYPLTVETKGGTVPFLARSILITSNQTPLEWYSSTAV
PAVEALYRRITSLVFWKNATEQSTEEGGQFVTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7las Mechanism of DNA Interaction and Translocation by the Replicase of a Circular Rep-Encoding Single-Stranded DNA Virus.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		W202 K240
Binding residue
(residue number reindexed from 1)		W84 K122
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0004519 endonuclease activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7las, PDBe:7las, PDBj:7las
PDBsum7las
PubMed34311576
UniProtQ6TC59

[Back to BioLiP]