Structure of PDB 7ktq Chain E Binding Site BS01

Receptor Information
>7ktq Chain E (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>7ktq Chain I (length=164) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacccgggatatcgagaatcccggtgccgaggccgctcaattggtcgtag
acagctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgtttta
accgccaaggggattactccctagtctccaggcacgtgtcagatatatac
atccgatatcccgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ktq Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R40 Y41 R49 K56 K64 L65 R69
Binding residue
(residue number reindexed from 1)		R3 Y4 R12 K19 K27 L28 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7ktq, PDBe:7ktq, PDBj:7ktq
PDBsum7ktq
PubMed33514705
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]