Structure of PDB 7kso Chain E Binding Site BS01

Receptor Information
>7kso Chain E (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKGKIKLL
LHWMPEDILPDVWVNEERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQK
Ligand information
>7kso Chain F (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKPKTEDFLTFLCLRGSPALPNS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kso Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		I411 E420
Binding residue
(residue number reindexed from 1)		I16 E25
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7kso, PDBe:7kso, PDBj:7kso
PDBsum7kso
PubMed33514705
UniProtQ6ZN18|AEBP2_HUMAN Zinc finger protein AEBP2 (Gene Name=AEBP2)

[Back to BioLiP]