Structure of PDB 7k7h Chain E Binding Site BS01

Receptor Information
>7k7h Chain E (length=114) Species: 220341 (Salmonella enterica subsp. enterica serovar Typhi str. CT18) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWTGDNTNAYYSDEVISELHVGQIDTSPYFCIKTVKANGSGTPVVACAVS
KQSIWAPSFKELLDQARYFYSTGQSVRIHVQKNIWTYPLFVNTFSANALV
GLSSCSATQCFGPK
Ligand information
>7k7h Chain G (length=14) Species: 220341 (Salmonella enterica subsp. enterica serovar Typhi str. CT18) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FYDARPVIELILSK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7h The structural basis of Salmonella A 2 B 5 toxin neutralization by antibodies targeting the glycan-receptor binding subunits.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D87 S94
Binding residue
(residue number reindexed from 1)		D64 S71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7k7h, PDBe:7k7h, PDBj:7k7h
PDBsum7k7h
PubMed34496256
UniProtQ8Z6A3

[Back to BioLiP]