Structure of PDB 7jrj Chain E Binding Site BS01

Receptor Information

>7jrj Chain E (length=180) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LGKMEYPPPGDKFEGTMEHGVRTGKGTYTWGVSGAVYTGDYVNGKKHGKG
KMVYPDKGVYEGDWVEDVMQGQGTYTYPNGDIYQGAFWAGKRHGKGMYHY
KGPCCQLVGDWADGGFTYGRWVYADGSMFMGKFGGAAADSKPTAGSYFYS
SSSLVQEGHFAKDGSWVGHRDPAVGKEFSV

Ligand information

>7jrj Chain L (length=6) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7jrj Structure of the radial spoke head and insights into its role in mechanoregulation of ciliary beating.
Resolution	3.03 Å
Binding residue (original residue number in PDB)	Y63 W65
Binding residue (residue number reindexed from 1)	Y28 W30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0016020	membrane

View graph for
Cellular Component

External links

PDB	RCSB:7jrj, PDBe:7jrj, PDBj:7jrj
PDBsum	7jrj
PubMed	33318704
UniProt	Q27YU4

[Back to BioLiP]