Structure of PDB 7fji Chain E Binding Site BS01

Receptor Information
>7fji Chain E (length=209) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEG
RPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITR
ALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVM
TKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAG
RYITYRLVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fji Structural insights into RNA polymerase III-mediated transcription termination through trapping poly-deoxythymidine.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		I84 T111 S113
Binding residue
(residue number reindexed from 1)		I83 T110 S112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006362 transcription elongation by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0042797 tRNA transcription by RNA polymerase III
GO:0050821 protein stabilization
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0005829 cytosol
GO:1990062 RPAP3/R2TP/prefoldin-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fji, PDBe:7fji, PDBj:7fji
PDBsum7fji
PubMed34675218
UniProtP19388|RPAB1_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC1 (Gene Name=POLR2E)

[Back to BioLiP]