Structure of PDB 7fj2 Chain E Binding Site BS01

Receptor Information
>7fj2 Chain E (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWK
NSIRHNLSLHDMFVRETSANGKVSFWTIH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fj2 Mechanistic Insights into the Preference for Tandem Binding Sites in DNA Recognition by FOXM1.
Resolution3.098 Å
Binding residue
(original residue number in PDB)		Y241 S284 H287
Binding residue
(residue number reindexed from 1)		Y9 S52 H55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7fj2, PDBe:7fj2, PDBj:7fj2
PDBsum7fj2
PubMed34973238
UniProtQ08050|FOXM1_HUMAN Forkhead box protein M1 (Gene Name=FOXM1)

[Back to BioLiP]