Structure of PDB 7f3i Chain E Binding Site BS01

Receptor Information
>7f3i Chain E (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLR
SVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f3i Crystal structure of human YBX2 CSD in complex with m5C RNA in space group P212121
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R104 N105 Q123
Binding residue
(residue number reindexed from 1)		R18 N19 Q37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7f3i, PDBe:7f3i, PDBj:7f3i
PDBsum7f3i
PubMed
UniProtQ9Y2T7|YBOX2_HUMAN Y-box-binding protein 2 (Gene Name=YBX2)

[Back to BioLiP]