Structure of PDB 7eu4 Chain E Binding Site BS01

Receptor Information
>7eu4 Chain E (length=94) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLH
SDSLFVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eu4 Atg12-Interacting Motif Is Crucial for E2-E3 Interaction in Plant Atg8 System.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F30 K31 F44
Binding residue
(residue number reindexed from 1)		F30 K31 F44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000045 autophagosome assembly
GO:0006914 autophagy
GO:0015031 protein transport
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eu4, PDBe:7eu4, PDBj:7eu4
PDBsum7eu4
PubMed34193767
UniProtQ9LVK3|AT12B_ARATH Ubiquitin-like protein ATG12B (Gene Name=ATG12B)

[Back to BioLiP]