Structure of PDB 7cr6 Chain E Binding Site BS01

Receptor Information
>7cr6 Chain E (length=92) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYLIIYDVPATKAGNKRRTRLFDLLSGYGKWRQFSVFECFLSVKQFAKLQ
TAMEKLIKLDEDAVCIYVLDENTVQRTITYGTPQPEKPGSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cr6 Mechanisms of spacer acquisition by sequential assembly of the adaptation module in Synechocystis.
Resolution3.72 Å
Binding residue
(original residue number in PDB)		Y7 D8 V9 P10 A11 R19 F23 F35
Binding residue
(residue number reindexed from 1)		Y6 D7 V8 P9 A10 R18 F22 F34
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7cr6, PDBe:7cr6, PDBj:7cr6
PDBsum7cr6
PubMed33619565
UniProtQ6ZEI1|CAS2A_SYNY3 CRISPR-associated endoribonuclease Cas2 1 (Gene Name=cas2-1)

[Back to BioLiP]