Structure of PDB 7co1 Chain E Binding Site BS01

Receptor Information
>7co1 Chain E (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGL
LSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQR
YGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIR
MSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7co1 Structural basis for transcriptional coactivator recognition by SMAD2 in TGF-beta signaling.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		G342 N387 Q388 A391 A392 W448 V452 Q455
Binding residue
(residue number reindexed from 1)		G77 N122 Q123 A126 A127 W183 V187 Q190
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7co1, PDBe:7co1, PDBj:7co1
PDBsum7co1
PubMed33323411
UniProtQ15796|SMAD2_HUMAN Mothers against decapentaplegic homolog 2 (Gene Name=SMAD2)

[Back to BioLiP]