Structure of PDB 7cfc Chain E Binding Site BS01

Receptor Information
>7cfc Chain E (length=161) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFLLPPKGGTETTRRDIYNQILKDMAAFPENTIVTAVLASVDVTDNCAYV
APLQELDQLPDYGDIFAVLDSINNIITRITINSSSAGGGYDAYLIDFGEH
IHFDGNETIFKLPDDIKRLPAQAIRCDLINCDIANMHCFVNTYIKIRVHE
NNNSTLVAEPV
Ligand information
>7cfc Chain I (length=10) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRARLIDTLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cfc Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D328 T330 D331 H403 H405 D407
Binding residue
(residue number reindexed from 1)		D42 T44 D45 H100 H102 D104
Enzymatic activity
Enzyme Commision number ?
External links