Structure of PDB 7c94 Chain E Binding Site BS01

Receptor Information
>7c94 Chain E (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLKLSCAASGFTFTRYAMSWVRQTPEKRLEWVAT
ISNGGSYTYYLDSVKGRFTLSRDNAKNTLYLQMSSLRSEDTAMYYCARRE
GGQAGPAWFVYWGQGTLVTVSAAKTTPPSVYPLAPGSQTNSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPRDCG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c94 Crystal structure of an anti-podoplanin antibody bound to a disialylated O-linked glycopeptide.
Resolution2.84 Å
Binding residue
(original residue number in PDB)		S52 N53 G54 S56 Y57 Y59 G102 Q103 A104 G105 P106
Binding residue
(residue number reindexed from 1)		S52 N53 G54 S56 Y57 Y59 G102 Q103 A104 G105 P106
External links