Structure of PDB 7bv4 Chain E Binding Site BS01

Receptor Information
>7bv4 Chain E (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYL
VPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bv4 Decoding three distinct states of the Syntaxin17 SNARE motif in mediating autophagosome-lysosome fusion.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P10 E12 S16
Binding residue
(residue number reindexed from 1)		P10 E12 S16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000226 microtubule cytoskeleton organization
GO:0000422 autophagy of mitochondrion
GO:0006605 protein targeting
GO:0006914 autophagy
GO:0006915 apoptotic process
GO:0006995 cellular response to nitrogen starvation
GO:0007268 chemical synaptic transmission
GO:0008625 extrinsic apoptotic signaling pathway via death domain receptors
GO:0015031 protein transport
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035020 regulation of Rac protein signal transduction
GO:0097352 autophagosome maturation
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1902524 positive regulation of protein K48-linked ubiquitination
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005790 smooth endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0097225 sperm midpiece
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bv4, PDBe:7bv4, PDBj:7bv4
PDBsum7bv4
PubMed32817423
UniProtO95166|GBRAP_HUMAN Gamma-aminobutyric acid receptor-associated protein (Gene Name=GABARAP)

[Back to BioLiP]