Structure of PDB 7bqz Chain E Binding Site BS01

Receptor Information
>7bqz Chain E (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFD
CVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETED
GSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMEP
GEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVY
DLVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bqz Molecular basis for histone H3 "K4me3-K9me3/2" methylation pattern readout by Spindlin1.
Resolution3.101 Å
Binding residue
(original residue number in PDB)		W62 W72 Y91 F94 D95 C96 Y98 F141 E142 W151 Y170 Y177 Y179 D184 D189 F251
Binding residue
(residue number reindexed from 1)		W17 W27 Y46 F49 D50 C51 Y53 F96 E97 W106 Y125 Y132 Y134 D139 D144 F195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:7bqz, PDBe:7bqz, PDBj:7bqz
PDBsum7bqz
PubMed32994220
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]