Structure of PDB 7bai Chain E Binding Site BS01

Receptor Information
>7bai Chain E (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQ
FSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQ
TLYSKWKDFHFEKIPFDPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bai A conserved isoleucine in the RNA sensor RIG-I controls immune tolerance to mitochondrial RNA
Resolution3.4 Å
Binding residue
(original residue number in PDB)
C829 H830 F853 K858 K861 G874 K888 K907 K909
Binding residue
(residue number reindexed from 1)
C27 H28 F51 K56 K59 G72 K86 K105 K107
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:7bai, PDBe:7bai, PDBj:7bai
PDBsum7bai
PubMed
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]