Structure of PDB 6y0x Chain E Binding Site BS01

Receptor Information

>6y0x Chain E (length=89) Species: 305 (Ralstonia solanacearum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSV
TSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTAT

Ligand information

>6y0x Chain O (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KYAKALAAAAAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6y0x Fucosylated antimicrobial peptide SB6 in complex with the lectin LecRSL from Ralstonia solanacearum at 2.4 Angstrom resolution
Resolution	2.425 Å
Binding residue (original residue number in PDB)	A58 I59 W76 D77 G78
Binding residue (residue number reindexed from 1)	A58 I59 W76 D77 G78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6y0x, PDBe:6y0x, PDBj:6y0x
PDBsum	6y0x
PubMed
UniProt	A0A0S4TLR1

[Back to BioLiP]