Structure of PDB 6xxs Chain E Binding Site BS01

Receptor Information
>6xxs Chain E (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSG
LFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAV
MATAMYLQMEHVVDTCRKFIKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xxs Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
M51 A52 C53 Y58 H116 F124
Binding residue
(residue number reindexed from 1)
M46 A47 C48 Y53 H111 F119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xxs, PDBe:6xxs, PDBj:6xxs
PDBsum6xxs
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]