--> -->

Structure of PDB 6xb9 Chain E Binding Site BS01

Receptor Information

>6xb9 Chain E (length=193) Species: 354 (Azotobacter vinelandii)

LRLDRLRDFVSALGELLDRHPDEESVLREGRSLLGELVRHDDWLPEEFAQ
PDPERYQQYLLHADSRQRFSVVSFVWGPGQTTPVHDHRVWGLIGMLRGAE
DAQSFELGAEGLRPIGDPVRLSPGQVEAVSPRIGDIHRVFNASPDQPSIS
IHVYGANIGAVRRAVYLPDGSEKPFISGYSNQFLPNIWDQSKE

IndexError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 01:39:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6xb9', asym_id = 'E', bs = 'BS01', title = 'Structure of 3-mercaptopropionic acid dioxygenas...s bidentate substrate binding at the iron center.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6xb9', asym_id='E', bs='BS01', title='Structure of 3-mercaptopropionic acid dioxygenas...s bidentate substrate binding at the iron center.')

    925                 p=subprocess.Popen(cmd,shell=True,stdout=subprocess.PIPE)

    926                 stdout,stderr=p.communicate()

=>  927                 line     =stdout.decode().splitlines()[0]

    928                 items    =line.split('\t')

    929                 rhea     ='\n'.join(["RHEA:"+r for r in items[2].split(',')])

line = '6xb9\tE\tFE\t1', stdout = b'', stdout.decode = <built-in method decode of bytes object>, ).splitlines undefined

IndexError: list index out of range
      args = ('list index out of range',)
      with_traceback = <built-in method with_traceback of IndexError object>