Structure of PDB 6ugf Chain E Binding Site BS01

Receptor Information
>6ugf Chain E (length=312) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPQNSAGDSFDASAYDAYIVQAVRGTMNTMSLDDIIGMHDVKQVLHEAVT
LPLLVPEFFQGLRSPWKAMVLAGPPGTGKTLIARAIASESSSTFFTVSST
DLSSKWRGDSEKIVRLLFELARFYAPSIIFIDQIDTLGGQRGNSGEHEAS
RRVKSEFLVQMDGSQNKFDSRRVFVLAATNIPWELDEALRRRFEKRIFIP
LPDIDARKKLIEKSMEGTPKSDEINYDDLAARTEGFSGADVVSLCRTAAI
NVLRRYDTKSLRGGELTAAMESLKAELVRNIDFEAALQAVSPSAGPDTML
KCKEWCDSFGAM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ugf Katanin Grips the beta-Tubulin Tail through an Electropositive Double Spiral to Sever Microtubules.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		W266 H307
Binding residue
(residue number reindexed from 1)		W106 H147
Enzymatic activity
Enzyme Commision number 5.6.1.1: microtubule-severing ATPase.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008017 microtubule binding
GO:0008568 microtubule severing ATPase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0019903 protein phosphatase binding
GO:0042802 identical protein binding
GO:0060090 molecular adaptor activity
GO:0090736 MATH domain binding
Biological Process
GO:0000212 meiotic spindle organization
GO:0000226 microtubule cytoskeleton organization
GO:0007019 microtubule depolymerization
GO:0007143 female meiotic nuclear division
GO:0009792 embryo development ending in birth or egg hatching
GO:0051013 microtubule severing
GO:0051229 meiotic spindle disassembly
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0071688 striated muscle myosin thick filament assembly
GO:1902120 negative regulation of meiotic spindle elongation
Cellular Component
GO:0000785 chromatin
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0008352 katanin complex
GO:0015630 microtubule cytoskeleton
GO:0072687 meiotic spindle
GO:0090619 meiotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ugf, PDBe:6ugf, PDBj:6ugf
PDBsum6ugf
PubMed31735665
UniProtP34808|KTNA1_CAEEL Meiotic spindle formation protein mei-1 (Gene Name=mei-1)

[Back to BioLiP]