Structure of PDB 6tqn Chain E Binding Site BS01

Receptor Information
>6tqn Chain E (length=98) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTV
LISPHVNDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Ligand information
>6tqn Chain R (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugcucuuuaacaauuuaucagaucuguguggguggcguguggc
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqn Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		D14 H15
Binding residue
(residue number reindexed from 1)		D13 H14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0008023 transcription elongation factor complex
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqn, PDBe:6tqn, PDBj:6tqn
PDBsum6tqn
PubMed32871103
UniProtP0A7R5|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]