Structure of PDB 6t9l Chain E Binding Site BS01

Receptor Information
>6t9l Chain E (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>6t9l Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t9l Structure of the transcription coactivator SAGA.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R40 Y41 V46 R49 L65 R83
Binding residue
(residue number reindexed from 1)		R1 Y2 V7 R10 L26 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6t9l, PDBe:6t9l, PDBj:6t9l
PDBsum6t9l
PubMed31969703
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]