Structure of PDB 6scf Chain E Binding Site BS01

Receptor Information
>6scf Chain E (length=112) Species: 157898 (Sulfolobus islandicus rod-shaped virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTIQ
LINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLYE
SGKVQFFEIIVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6scf An anti-CRISPR viral ring nuclease subverts type III CRISPR immunity.
Resolution1.55 Å
Binding residue
(original residue number in PDB)
N8 A9 S11 N13 A47 T50 R66 E68 I69 Q81 I82 R85 L92
Binding residue
(residue number reindexed from 1)
N6 A7 S9 N11 A45 T48 R64 E66 I67 Q79 I80 R83 L90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6scf, PDBe:6scf, PDBj:6scf
PDBsum6scf
PubMed31942067
UniProtQ8QL27|Y114_SIRV1 Uncharacterized protein 114 (Gene Name=114)

[Back to BioLiP]