Structure of PDB 6rr0 Chain E Binding Site BS01

Receptor Information
>6rr0 Chain E (length=113) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFANN
LKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKKKARFWSFMK
TQRFVSNMGFDIQ
Ligand information
>6rr0 Chain J (length=9) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
STELSTEPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rr0 The Sir4 H-BRCT domain interacts with phospho-proteins to sequester and repress yeast heterochromatin.
Resolution2.18 Å
Binding residue
(original residue number in PDB)
W974 E977 W978 R1066 W1068 K1072 R1075 N1079
Binding residue
(residue number reindexed from 1)
W5 E8 W9 R94 W96 K100 R103 N107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6rr0, PDBe:6rr0, PDBj:6rr0
PDBsum6rr0
PubMed31515872
UniProtP11978|SIR4_YEAST Regulatory protein SIR4 (Gene Name=SIR4)

[Back to BioLiP]