Structure of PDB 6rpa Chain E Binding Site BS01

Receptor Information

>6rpa Chain E (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAVISQKPSRDIKQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATAN
QGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVGGSGG
ADTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATG
FYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSAT
FWQDPRNHFRCQVQFYGLSENDEAKPVTQIVSAEA

Ligand information

>6rpa Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLLMWITQV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6rpa TCRs with Distinct Specificity Profiles Use Different Binding Modes to Engage an Identical Peptide-HLA Complex.
Resolution	2.56 Å
Binding residue (original residue number in PDB)	S109 G110 G112
Binding residue (residue number reindexed from 1)	S98 G99 G100

External links

PDB	RCSB:6rpa, PDBe:6rpa, PDBj:6rpa
PDBsum	6rpa
PubMed	32102902

[Back to BioLiP]