Structure of PDB 6rp9 Chain E Binding Site BS01

Receptor Information

>6rp9 Chain E (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GAGVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFN
YEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSSPGGV
STEAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATG
FYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSAT
FWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA

Ligand information

>6rp9 Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLLMWITQV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6rp9 TCRs with Distinct Specificity Profiles Use Different Binding Modes to Engage an Identical Peptide-HLA Complex.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	Y58 G110 G111
Binding residue (residue number reindexed from 1)	Y51 G98 G99

External links

PDB	RCSB:6rp9, PDBe:6rp9, PDBj:6rp9
PDBsum	6rp9
PubMed	32102902

[Back to BioLiP]