Structure of PDB 6pe0 Chain E Binding Site BS01

Receptor Information

>6pe0 Chain E (length=279) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EKNERTRIKAQENLRRIRRKQIDLVLNEYENQVALEVVAPEDIPVGFNDI
GGLDDIIEELKETIIYPLTMPHLYKHGGALLAAPSGVLLYGPPGCGKTML
AKAVAHESGASFINLHISTLTEKWYGDSNKIVRAVFSLAKKLQPSIIFID
QIDAVLGTRRSGEHEASGMVKAEFMTLWDGLTSTNASGVPNRIVVLGATN
RINDIDEAILRRMPKQFPVPLPGLEQRRRILELVLRGTKRDPDFDLDYIA
RVTAGMSGSDIKETCRDAAMAPMREYIRQ

Ligand information

>6pe0 Chain G (length=10) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pe0 Structure of the AAA protein Msp1 reveals mechanism of mislocalized membrane protein extraction.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	K186 W187 Y188
Binding residue (residue number reindexed from 1)	K123 W124 Y125

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0140570	extraction of mislocalized protein from mitochondrial outer membrane

	Cellular Component
GO:0005741	mitochondrial outer membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pe0, PDBe:6pe0, PDBj:6pe0
PDBsum	6pe0
PubMed	31999255
UniProt	G0S654

[Back to BioLiP]