Structure of PDB 6p0s Chain E Binding Site BS01

Receptor Information
>6p0s Chain E (length=52) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p0s Cooperative DNA binding by proteins through DNA shape complementarity.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		L5 E19 R22 R26 K36 R39 E40 Y41
Binding residue
(residue number reindexed from 1)		L5 E19 R22 R26 K36 R39 E40 Y41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p0s, PDBe:6p0s, PDBj:6p0s
PDBsum6p0s
PubMed31616952
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]