Structure of PDB 6o7i Chain E Binding Site BS01

Receptor Information
>6o7i Chain E (length=279) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGG
ARISSAFPYSGDTYYLPKPLSVEPALEGILRYTTAKRLRKAKYLDLKNFE
LALRLRPFTIPEEIPYARVDVPRVVLDRVTQDSSIYFWEEIRFREKSGVY
FLYSGPREVFDGYIAPAMRFLGDTGIGGKSTWGAGLFEVEFHEMKIDAPG
SEYSVTLSNALPTKTPVLWRLLRKGGWSFGRRKPRMTFIAEGSIVKNDPG
GMERLELGLSHEVYVYGLTFPLGVELPEG
Ligand information
>6o7i Chain G (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaggcgggcagaggcgguuug
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o7i Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R16 T23 G26 N30 S33 V41 P130 V132 V133 L134 R136 Q139 I143 Y144 G183 I184 G185 G186 G233 G234 W235 S236 K241 R243 H269 E270 Y272
Binding residue
(residue number reindexed from 1)		R15 T22 G25 N29 S32 V40 P122 V124 V125 L126 R128 Q131 I135 Y136 G175 I176 G177 G178 G225 G226 W227 S228 K233 R235 H261 E262 Y264
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o7i, PDBe:6o7i, PDBj:6o7i
PDBsum6o7i
PubMed31326272
UniProtB6YWC1|CSM4_THEON CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]