Structure of PDB 6nah Chain E Binding Site BS01

Receptor Information
>6nah Chain E (length=174) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIYSRLLKERIVFLVGPVTDESANLVVAQLLFLESENPDKDIFFYINSPG
GSVTAGMSIYDTMNFIKPDVSTLCLGQAASMGAFLLSAGEKGKRFALPNS
RIMIHQPLISLGGQASDIEIHARELLKIKEKLNRLMAKHCDRDLADLERD
TDRDNFMSAEEAKEYGLIDQILEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nah ClpP protease activation results from the reorganization of the electrostatic interaction networks at the entrance pores.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
E31 I33 F65 Y67 L95 F117 L119
Binding residue
(residue number reindexed from 1)
E9 I11 F43 Y45 L73 F95 L97
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6nah, PDBe:6nah, PDBj:6nah
PDBsum6nah
PubMed31925204
UniProtQ9JZ38|CLPP_NEIMB ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]