Structure of PDB 6mut Chain E Binding Site BS01

Receptor Information
>6mut Chain E (length=286) Species: 342948 (Thermococcus onnurineus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGG
ARISSAFPYSGDTYYLPKPLSVEPALEGILTGLDEEERYTTAKRLRKAKY
LDLKNFELALRLRPFTIPEEIPYARVDVPRVVLDRVTQDSSIYFWEEIRF
REKSGVYFLYSGPREVFDGYIAPAMRFLGDTGIGGKSTWGAGLFEVEFHE
MKIDAPGSEYSVTLSNALPTKTPVLWRLLRKGGWSFGRRKPRMTFIAEGS
IVKNDPGGMERLELGLSHEVYVYGLTFPLGVELPEG
Ligand information
>6mut Chain G (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaggcgggcagaggc
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mut Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R16 T23 G26 N30 S33 Q38 V41 P130 R131 V132 V133 L134 R136 Q139 S141 I143 Y144 I184 G185 G186 K187 G233 G234 W235 S236 F237 K241 H269 E270 Y272
Binding residue
(residue number reindexed from 1)		R15 T22 G25 N29 S32 Q37 V40 P129 R130 V131 V132 L133 R135 Q138 S140 I142 Y143 I183 G184 G185 K186 G232 G233 W234 S235 F236 K240 H268 E269 Y271
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6mut, PDBe:6mut, PDBj:6mut
PDBsum6mut
PubMed30503773
UniProtB6YWC1|CSM4_THEON CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]