Structure of PDB 6mus Chain E Binding Site BS01

Receptor Information
>6mus Chain E (length=279) Species: 342948 (Thermococcus onnurineus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGG
ARISSAFPYSGDTYYLPKPLSVEPALEGILRYTTAKRLRKAKYLDLKNFE
LALRLRPFTIPEEIPYARVDVPRVVLDRVTQDSSIYFWEEIRFREKSGVY
FLYSGPREVFDGYIAPAMRFLGDTGIGGKSTWGAGLFEVEFHEMKIDAPG
SEYSVTLSNALPTKTPVLWRLLRKGGWSFGRRKPRMTFIAEGSIVKNDPG
GMERLELGLSHEVYVYGLTFPLGVELPEG
Ligand information
>6mus Chain G (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaggcgggcagaggcgguuugcguauug
.................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mus Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		T23 F25 G26 A27 G29 N30 S33 V41 V132 V133 L134 R136 Q139 S141 I143 Y144 I184 G185 G186 K187 G233 G234 W235 S236 K241 R243 H269 E270 Y272
Binding residue
(residue number reindexed from 1)		T22 F24 G25 A26 G28 N29 S32 V40 V124 V125 L126 R128 Q131 S133 I135 Y136 I176 G177 G178 K179 G225 G226 W227 S228 K233 R235 H261 E262 Y264
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6mus, PDBe:6mus, PDBj:6mus
PDBsum6mus
PubMed30503773
UniProtB6YWC1|CSM4_THEON CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]