Structure of PDB 6m64 Chain E Binding Site BS01

Receptor Information
>6m64 Chain E (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGL
LSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQR
YGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIR
MSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGS
Ligand information
>6m64 Chain F (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPAAVEAARQILREAQQQQHLYSDED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m64 Structural basis for transcriptional coactivator recognition by SMAD2 in TGF-beta signaling.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		G342 G343 N387 Q388 A391 A395 V398 W448 Q455
Binding residue
(residue number reindexed from 1)		G77 G78 N122 Q123 A126 A130 V133 W183 Q190
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6m64, PDBe:6m64, PDBj:6m64
PDBsum6m64
PubMed33323411
UniProtQ15796|SMAD2_HUMAN Mothers against decapentaplegic homolog 2 (Gene Name=SMAD2)

[Back to BioLiP]