Structure of PDB 6lxt Chain E Binding Site BS01

Receptor Information

>6lxt Chain E (length=114) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVK
QLSSNFGAISSVLNDILSRLDKVEDVDLGDISGINASVVNIQKEIDRLNE
VAKNLNESLIDLQE

Ligand information

InChI=1S/Zn/q+2

PTFCDOFLOPIGGS-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Zn++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Zn+2]

Formula

Zn

Name

ZINC ION

PDB chain

6lxt Chain A Residue 1304 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6lxt Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D1163 D1165
Binding residue (residue number reindexed from 1)	D75 D77
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0019064	fusion of virus membrane with host plasma membrane
GO:0039654	fusion of virus membrane with host endosome membrane
GO:0046813	receptor-mediated virion attachment to host cell
GO:0075509	endocytosis involved in viral entry into host cell

	Cellular Component
GO:0016020	membrane
GO:0019031	viral envelope
GO:0055036	virion membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lxt, PDBe:6lxt, PDBj:6lxt
PDBsum	6lxt
PubMed	32231345
UniProt	P0DTC2\|SPIKE_SARS2 Spike glycoprotein (Gene Name=S)

[Back to BioLiP]