Structure of PDB 6l0v Chain E Binding Site BS01

Receptor Information
>6l0v Chain E (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKEWVEQDEPGVYITLTALAGGARDLKRVRFSRKRFSEIQAEQWWADNRG
RVYEQYNVRM
Ligand information
>6l0v Chain F (length=16) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPKWVKTDSDFIVLEI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l0v Polar recruitment of RLD by LAZY1-like protein during gravity signaling in root branch angle control.
Resolution1.347 Å
Binding residue
(original residue number in PDB)		L1031 K1032 R1033 V1034 R1035 F1036 S1037 R1038 S1042 E1043 A1046 E1047 W1050
Binding residue
(residue number reindexed from 1)		L26 K27 R28 V29 R30 F31 S32 R33 S37 E38 A41 E42 W45
Enzymatic activity
Enzyme Commision number ?
External links