Structure of PDB 6jxd Chain E Binding Site BS01

Receptor Information
>6jxd Chain E (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6jxd Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
catatatcccggtgccgaggccgctcaattggtcgtagacagctctagca
ccgcttaaacgcacgtacgcgctgtctaccgcgttttaaccgccactaga
agcgcttactagtctccaggcacgtgtgagaccggcatatatggtac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxd PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 P43 G44 V46 R49 K56 R63 K64 L65 R69 R83
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 G7 V9 R12 K19 R26 K27 L28 R32 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jxd, PDBe:6jxd, PDBj:6jxd
PDBsum6jxd
PubMed31848352
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]