Structure of PDB 6jm9 Chain E Binding Site BS01

Receptor Information
>6jm9 Chain E (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>6jm9 Chain I (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacctgcagattctaccaaaagtgtatttggaaactgctccatcaaaagg
catgttcagctgaattcagctgaacatgccttttgatggagcagtttcca
aatacacttttggtagaatctgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jm9 Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
Resolution7.3 Å
Binding residue
(original residue number in PDB)		R40 Y41 P43 G44 V46 A47 R63 K64 L65 P66 R69 R83
Binding residue
(residue number reindexed from 1)		R3 Y4 P6 G7 V9 A10 R26 K27 L28 P29 R32 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jm9, PDBe:6jm9, PDBj:6jm9
PDBsum6jm9
PubMed30923167
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]