Structure of PDB 6j99 Chain E Binding Site BS01

Receptor Information
>6j99 Chain E (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>6j99 Chain I (length=144) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagca
ccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagggg
attactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j99 Structural basis of the crosstalk between histone H2B monoubiquitination and H3 lysine 79 methylation on nucleosome.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 P43 V46 R49 R63 K64 L65 P66 R69
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 P6 V9 R12 R26 K27 L28 P29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6j99, PDBe:6j99, PDBj:6j99
PDBsum6j99
PubMed30770869
UniProtA0A310TTQ1

[Back to BioLiP]