Structure of PDB 6j40 Chain E Binding Site BS01

Receptor Information
>6j40 Chain E (length=75) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFT
QDRQQVPLVNDRFSAKQELEDLTKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j40 Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
L31 F32 S34 G35 W36 F38 I39
Binding residue
(residue number reindexed from 1)
L23 F24 S26 G27 W28 F30 I31
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Dec 1 01:45:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6j40', asym_id = 'E', bs = 'BS01', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6j40', asym_id='E', bs='BS01', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot = '', pdbid = '6j40', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot='', pdbid='6j40', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>