Structure of PDB 6j3y Chain E Binding Site BS01

Receptor Information
>6j3y Chain E (length=75) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFT
QDRQQVPLVNDRFSAKQELEDLTKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j3y Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		L31 F32 S34 G35 W36 F38 I39 P53
Binding residue
(residue number reindexed from 1)		L23 F24 S26 G27 W28 F30 I31 P45
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 01:41:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6j3y', asym_id = 'E', bs = 'BS01', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6j3y', asym_id='E', bs='BS01', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot = '', pdbid = '6j3y', asym_id = 'E'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009523,0009539,0009767,0015979,0016020,0019684,0020037,0046872', uniprot='', pdbid='6j3y', asym_id='E')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>