Structure of PDB 6iy2 Chain E Binding Site BS01

Receptor Information
>6iy2 Chain E (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>6iy2 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgcaacagtcctaacattcacctcttgtgtgtttgtgtctgttcgcc
atcccgtctccgctcgtcacttatccttcactttccagagggtccccccg
cagaccccggcgaccctcaggtcggccgactgcggcacagttttgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iy2 Mechanism of DNA translocation underlying chromatin remodelling by Snf2.
Resolution3.47 Å
Binding residue
(original residue number in PDB)		K37 R40 Y41 P43 V46 R49 R63 L65 R69 R83
Binding residue
(residue number reindexed from 1)		K1 R4 Y5 P7 V10 R13 R27 L29 R33 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6iy2, PDBe:6iy2, PDBj:6iy2
PDBsum6iy2
PubMed30867599
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]