Structure of PDB 6iqw Chain E Binding Site BS01

Receptor Information
>6iqw Chain E (length=277) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGG
ARISSAFPYSGDTYYLPKPLSVEPALEGILTGLDEEERYTTAKRLRKAKY
LDLKNFELALRLRPFTIPEEIPYARVDVPRVVLDRVTQDSSIYFWEEIRF
REKSGVYFLYSGPREVFDGYIAPAMRFLGWGAGLFEVEFHEMKIDAPGSE
YSVTLSNALPTKTPVLWRLLRKGGWSFGRRKPRMTFIAEGSIVKNDPGGM
ERLELGLSHEVYVYGLTFPLGVELPEG
Ligand information
>6iqw Chain I (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaguggcccgaaacccuuc
........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iqw Cryo-EM structure of Type III-A CRISPR effector complex.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		G26 G29 N30 V41 E42 P130 V132 V133 L134 R136 Q139 D140 I143 Y144 R231 K232 G233 G234 W235 S236 F237 R243 H269 V271 Y272
Binding residue
(residue number reindexed from 1)		G25 G28 N29 V40 E41 P129 V131 V132 L133 R135 Q138 D139 I142 Y143 R221 K222 G223 G224 W225 S226 F227 R233 H259 V261 Y262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6iqw, PDBe:6iqw, PDBj:6iqw
PDBsum6iqw
PubMed30459428
UniProtB6YWC1|CSM4_THEON CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]