Structure of PDB 6ifz Chain E Binding Site BS01

Receptor Information
>6ifz Chain E (length=207) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAINSPVIKDPITNLPIIPGSS
LKGKMRTLLAKVYNESDILSRLFGNSKDKRFKMGRLIFRDAFLSNADELD
SLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFELIYEITDENE
NQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFENLKATTVFGNYDVK
TLNELLT
Ligand information
>6ifz Chain I (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuaccca
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifz Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.58 Å
Binding residue
(original residue number in PDB)		G21 S50 K53 G54 K55 S86 E123 N124 T125 I126 A133 R136 Y181 G184 S185 S187 R188
Binding residue
(residue number reindexed from 1)		G20 S49 K52 G53 K54 S76 E113 N114 T115 I116 A123 R126 Y171 G174 S175 S177 R178
External links