Structure of PDB 6ifr Chain E Binding Site BS01

Receptor Information
>6ifr Chain E (length=205) Species: 767463 (Streptococcus thermophilus ND03) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAINSPVIKDPITNLPIIPGSS
LKGKMRTLLAKVYNDILSRLFGNSKDKRFKMGRLIFRDAFLSNADELDSL
GVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFELIYEITDENENQ
VEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFENLKATTVFGNYDVKTL
NELLT
Ligand information
>6ifr Chain N (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacgcuuucuagcucgcuauaauuacccau
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifr Structure Studies of the CRISPR-Csm Complex Reveal Mechanism of Co-transcriptional Interference
Resolution3.4 Å
Binding residue
(original residue number in PDB)		I20 G21 D24 S50 S51 K53 G54 R57 G84 S86 M93 F122 E123 N124 T125 I126 A133 R136 Y181 G183 G184 S185 R188
Binding residue
(residue number reindexed from 1)		I19 G20 D23 S49 S50 K52 G53 R56 G72 S74 M81 F110 E111 N112 T113 I114 A121 R124 Y169 G171 G172 S173 R176
External links