Structure of PDB 6ifc Chain E Binding Site BS01

Receptor Information
>6ifc Chain E (length=132) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKS
LAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQM
IAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Ligand information
>6ifc Chain F (length=22) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SWDSWFDGEGASTDFMSTREQP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ifc Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		T8 I12 I15 K16 K18 R23 F26 N27 E42 G46 A47 S50 L51 R55 N56 V59 G62 F63 R66 G95 Y97 D98
Binding residue
(residue number reindexed from 1)		T8 I12 I15 K16 K18 R23 F26 N27 E42 G46 A47 S50 L51 R55 N56 V59 G62 F63 R66 G95 Y97 D98
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6ifc, PDBe:6ifc, PDBj:6ifc
PDBsum6ifc
PubMed31908032
UniProtQ8ZM86|VAPC_SALTY tRNA(fMet)-specific endonuclease VapC (Gene Name=vapC)

[Back to BioLiP]