Structure of PDB 6ht5 Chain E Binding Site BS01

Receptor Information
>6ht5 Chain E (length=101) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GADMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTIS
RFEALQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSETLVQARKRKRT
S
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ht5 Oct4/Sox2:UTF1 structure
Resolution3.451 Å
Binding residue
(original residue number in PDB)		R152 T158 Q159 Q176 T177 S180
Binding residue
(residue number reindexed from 1)		R22 T28 Q29 Q46 T47 S50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ht5, PDBe:6ht5, PDBj:6ht5
PDBsum6ht5
PubMed
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]