Structure of PDB 6h0e Chain E Binding Site BS01

Receptor Information

>6h0e Chain E (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVQLVQSGAEVKKPGAPVKVSCETSGYRFSDYFVHWVRQAPGQGPEWIGR
IRPNSGGTKYAQKFQGRVTMTRDMSMNTAYMELSGLRSDDTAVYYCVRGH
CDGTTCSRAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEP

Ligand information

>6h0e Chain J (length=8) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MVDSPQLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6h0e Enhancement of therapeutic potential of a naturally occurring human antibody targeting a phosphorylated Ser422containing epitope on pathological tau.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	F33 H35 R50 R52 K59 G99 H100 C101 G103
Binding residue (residue number reindexed from 1)	F33 H35 R50 R52 K59 G99 H100 C101 G103

External links

PDB	RCSB:6h0e, PDBe:6h0e, PDBj:6h0e
PDBsum	6h0e
PubMed	30001207

[Back to BioLiP]