Structure of PDB 6h06 Chain E Binding Site BS01

Receptor Information
>6h06 Chain E (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGAEVKKPGAPVKVSCETSGYRFSDYNVHWVRQAPGQGPEWIGR
ISPNSGGTKYAQKFQGRVTMTRDMSMNTAYMELSGLRSDDTAVYYCVRGH
CDGTTCSRAYWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h06 Enhancement of therapeutic potential of a naturally occurring human antibody targeting a phosphorylated Ser422containing epitope on pathological tau.
Resolution2.63 Å
Binding residue
(original residue number in PDB)
N33 H35 H100 C101 G103
Binding residue
(residue number reindexed from 1)
N33 H35 H100 C101 G103
External links